Placeholder image of a protein
Icon representing a puzzle

1344: Unsolved De-novo Freestyle 101

Closed since about 9 years ago

Intermediate Overall Prediction

Summary


Created
February 20, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


MLQLLLAVFIGGGTGSVARWLLSMRFNPLHQAIPLGTLTANLIGAFIIGIGFAWFSRMTNIDPVWKVLITTGFCGGLTTFSTFSAEVVFLLQEGRFGWALLNVFVNLLGSFAMTALAFWLFSASTAH

Top groups


  1. Avatar for Deleted group 11. Deleted group pts. 8,574
  2. Avatar for xkcd 12. xkcd 4 pts. 8,553
  3. Avatar for HCC BIOL121 S2017 13. HCC BIOL121 S2017 2 pts. 8,269
  4. Avatar for Team South Africa 14. Team South Africa 2 pts. 8,252
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 8,206
  6. Avatar for Russian team 16. Russian team 1 pt. 8,155
  7. Avatar for Natural Abilities 17. Natural Abilities 1 pt. 8,137
  8. Avatar for GUGITBIOTECH 18. GUGITBIOTECH 1 pt. 7,865
  9. Avatar for LEC Metabolites 19. LEC Metabolites 1 pt. 7,253
  10. Avatar for BOINC@Poland 20. BOINC@Poland 1 pt. 6,510

  1. Avatar for smilingone 11. smilingone Lv 1 79 pts. 9,099
  2. Avatar for spvincent 12. spvincent Lv 1 77 pts. 9,099
  3. Avatar for jfryk 13. jfryk Lv 1 75 pts. 9,077
  4. Avatar for nicobul 14. nicobul Lv 1 73 pts. 9,072
  5. Avatar for Vredeman 15. Vredeman Lv 1 71 pts. 9,062
  6. Avatar for dcrwheeler 16. dcrwheeler Lv 1 70 pts. 9,057
  7. Avatar for reefyrob 17. reefyrob Lv 1 68 pts. 9,049
  8. Avatar for LociOiling 18. LociOiling Lv 1 66 pts. 9,020
  9. Avatar for frood66 19. frood66 Lv 1 65 pts. 9,017
  10. Avatar for ZeroLeak7 20. ZeroLeak7 Lv 1 63 pts. 8,963

Comments


Bruno Kestemont Lv 1

There are so many hydrophobic residues ! Could we suspect that this protein is for oily environment (meaning that orange should be outside and blue inside )?

Like puzzle series 1142-1145-1148 ,
http://fold.it/portal/node/2001287

Then considering adapted score function and bonus for hydrogen bond?

Indeed, the sequence is predicted to have at least 4 transmembrane regions (M = membrane = oily)
##############################################################################
OCTOPUS result file
Generated from http://octopus.cbr.su.se/ at 2017-02-21 16:42:11
Total request time: 20.95 seconds.
##############################################################################

Sequence name: query_sequence
Sequence length: 127 aa.
Sequence:
MLQLLLAVFIGGGTGSVARWLLSMRFNPLHQAIPLGTLTANLIGAFIIGIGFAWFSRMTN
IDPVWKVLITTGFCGGLTTFSTFSAEVVFLLQEGRFGWALLNVFVNLLGSFAMTALAFWL
FSASTAH

OCTOPUS predicted topology:
oMMMMMMMMMMMMMMMMMMMMMiiiiiiiiiiiiMMMMMMMMMMMMMMMMMMMMMooooo
oooooMMMMMMMMMMMMMMMMMMMMMiiiiiiiiiiiiMMMMMMMMMMMMMMMMMMMMMo
ooooooo

Then it would be a alpha-helical transmembrane protein and parts of the orange should be outside (the blue ones making hydrogen bonds). BUT the scoring function encourages orange inside isn't it?

Skippysk8s Lv 1

Bruno
makes me feel like I am not crazy. Plus has a flouride ligand and iron ligand as it matches the second chain…..
Nature or points game?

bkoep Staff Lv 1

This is believed to be a membrane protein, so the native structure will probably have orange (hydrophobic) residues on the outside with buried blue (polar) residues making internal hydrogen-bond networks. Since we haven't altered the score function to reflect the membrane environment, the native structure will probably not score very well in this puzzle. Expect a follow-up puzzle!

We're also a little curious to see how well Foldit players can bury the excess hydrophobics, i.e. if players can find a stable aqueous model for this sequence.