Placeholder image of a protein
Icon representing a puzzle

1344: Unsolved De-novo Freestyle 101

Closed since about 9 years ago

Intermediate Overall Prediction

Summary


Created
February 20, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


MLQLLLAVFIGGGTGSVARWLLSMRFNPLHQAIPLGTLTANLIGAFIIGIGFAWFSRMTNIDPVWKVLITTGFCGGLTTFSTFSAEVVFLLQEGRFGWALLNVFVNLLGSFAMTALAFWLFSASTAH

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,212
  2. Avatar for Beta Folders 2. Beta Folders 80 pts. 9,187
  3. Avatar for Void Crushers 3. Void Crushers 63 pts. 9,176
  4. Avatar for Go Science 4. Go Science 49 pts. 9,172
  5. Avatar for Contenders 5. Contenders 37 pts. 9,128
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 28 pts. 9,072
  7. Avatar for Gargleblasters 7. Gargleblasters 21 pts. 9,017
  8. Avatar for Italiani Al Lavoro 8. Italiani Al Lavoro 15 pts. 8,683
  9. Avatar for Deleted group 9. Deleted group pts. 8,596
  10. Avatar for Androids 10. Androids 8 pts. 8,584

  1. Avatar for MicElephant 61. MicElephant Lv 1 19 pts. 8,612
  2. Avatar for mitarcher 62. mitarcher Lv 1 19 pts. 8,608
  3. Avatar for justjustin 63. justjustin Lv 1 18 pts. 8,604
  4. Avatar for Museka 64. Museka Lv 1 17 pts. 8,597
  5. Avatar for drumpeter18yrs9yrs 65. drumpeter18yrs9yrs Lv 1 17 pts. 8,596
  6. Avatar for Anfinsen_slept_here 66. Anfinsen_slept_here Lv 1 16 pts. 8,595
  7. Avatar for fishercat 67. fishercat Lv 1 16 pts. 8,594
  8. Avatar for katling 68. katling Lv 1 15 pts. 8,591
  9. Avatar for hansvandenhof 69. hansvandenhof Lv 1 15 pts. 8,587
  10. Avatar for jobo0502 70. jobo0502 Lv 1 14 pts. 8,584

Comments


Bruno Kestemont Lv 1

There are so many hydrophobic residues ! Could we suspect that this protein is for oily environment (meaning that orange should be outside and blue inside )?

Like puzzle series 1142-1145-1148 ,
http://fold.it/portal/node/2001287

Then considering adapted score function and bonus for hydrogen bond?

Indeed, the sequence is predicted to have at least 4 transmembrane regions (M = membrane = oily)
##############################################################################
OCTOPUS result file
Generated from http://octopus.cbr.su.se/ at 2017-02-21 16:42:11
Total request time: 20.95 seconds.
##############################################################################

Sequence name: query_sequence
Sequence length: 127 aa.
Sequence:
MLQLLLAVFIGGGTGSVARWLLSMRFNPLHQAIPLGTLTANLIGAFIIGIGFAWFSRMTN
IDPVWKVLITTGFCGGLTTFSTFSAEVVFLLQEGRFGWALLNVFVNLLGSFAMTALAFWL
FSASTAH

OCTOPUS predicted topology:
oMMMMMMMMMMMMMMMMMMMMMiiiiiiiiiiiiMMMMMMMMMMMMMMMMMMMMMooooo
oooooMMMMMMMMMMMMMMMMMMMMMiiiiiiiiiiiiMMMMMMMMMMMMMMMMMMMMMo
ooooooo

Then it would be a alpha-helical transmembrane protein and parts of the orange should be outside (the blue ones making hydrogen bonds). BUT the scoring function encourages orange inside isn't it?

Skippysk8s Lv 1

Bruno
makes me feel like I am not crazy. Plus has a flouride ligand and iron ligand as it matches the second chain…..
Nature or points game?

bkoep Staff Lv 1

This is believed to be a membrane protein, so the native structure will probably have orange (hydrophobic) residues on the outside with buried blue (polar) residues making internal hydrogen-bond networks. Since we haven't altered the score function to reflect the membrane environment, the native structure will probably not score very well in this puzzle. Expect a follow-up puzzle!

We're also a little curious to see how well Foldit players can bury the excess hydrophobics, i.e. if players can find a stable aqueous model for this sequence.