Placeholder image of a protein
Icon representing a puzzle

1345: Revisiting Puzzle 89: Cow Eye

Closed since over 9 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
February 24, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein found at high concentrations of the lens of the eye; historically, this protein was purified from the eyes of B. taurus for research. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


TFRMRIYERDDFRGQMSEITDDCPSLQDRFHLTEVHSLNVLEGSWVLYEMPSYRGRQYLLRPGEYRRYLDWGAMNAKVGSLRRVMDFY

Top groups


  1. Avatar for Natural Abilities 11. Natural Abilities 5 pts. 9,315
  2. Avatar for Deleted group 12. Deleted group pts. 9,131
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 2 pts. 9,087
  4. Avatar for GUGITBIOTECH 14. GUGITBIOTECH 2 pts. 9,079
  5. Avatar for Deleted group 15. Deleted group pts. 9,063
  6. Avatar for LEC Metabolites 16. LEC Metabolites 1 pt. 8,919
  7. Avatar for FoldIt@Netherlands 17. FoldIt@Netherlands 1 pt. 8,907
  8. Avatar for BOINC@Poland 18. BOINC@Poland 1 pt. 8,879
  9. Avatar for HCC BIOL121 S2017 19. HCC BIOL121 S2017 1 pt. 8,820
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 8,722

  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 9,689
  2. Avatar for phi16 2. phi16 Lv 1 85 pts. 9,686
  3. Avatar for jfryk 3. jfryk Lv 1 71 pts. 9,684
  4. Avatar for lamoille 4. lamoille Lv 1 60 pts. 9,682
  5. Avatar for Deleted player 5. Deleted player pts. 9,675
  6. Avatar for alwen 6. alwen Lv 1 41 pts. 9,675
  7. Avatar for LociOiling 7. LociOiling Lv 1 33 pts. 9,662
  8. Avatar for smilingone 8. smilingone Lv 1 27 pts. 9,661
  9. Avatar for gitwut 9. gitwut Lv 1 22 pts. 9,658
  10. Avatar for toshiue 10. toshiue Lv 1 17 pts. 9,657

Comments