Placeholder image of a protein
Icon representing a puzzle

1345: Revisiting Puzzle 89: Cow Eye

Closed since about 9 years ago

Intermediate Overall Prediction

Summary


Created
February 24, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein found at high concentrations of the lens of the eye; historically, this protein was purified from the eyes of B. taurus for research. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


TFRMRIYERDDFRGQMSEITDDCPSLQDRFHLTEVHSLNVLEGSWVLYEMPSYRGRQYLLRPGEYRRYLDWGAMNAKVGSLRRVMDFY

Top groups


  1. Avatar for Natural Abilities 11. Natural Abilities 5 pts. 9,315
  2. Avatar for Deleted group 12. Deleted group pts. 9,131
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 2 pts. 9,087
  4. Avatar for GUGITBIOTECH 14. GUGITBIOTECH 2 pts. 9,079
  5. Avatar for Deleted group 15. Deleted group pts. 9,063
  6. Avatar for LEC Metabolites 16. LEC Metabolites 1 pt. 8,919
  7. Avatar for FoldIt@Netherlands 17. FoldIt@Netherlands 1 pt. 8,907
  8. Avatar for BOINC@Poland 18. BOINC@Poland 1 pt. 8,879
  9. Avatar for HCC BIOL121 S2017 19. HCC BIOL121 S2017 1 pt. 8,820
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 8,722

  1. Avatar for g14023 191. g14023 Lv 1 1 pt. 8,212
  2. Avatar for TitaniumGolem 192. TitaniumGolem Lv 1 1 pt. 8,105
  3. Avatar for Puttering 193. Puttering Lv 1 1 pt. 7,938
  4. Avatar for benrh 194. benrh Lv 1 1 pt. 7,657
  5. Avatar for rob147147 195. rob147147 Lv 1 1 pt. 7,657
  6. Avatar for 19147619_Burns 196. 19147619_Burns Lv 1 1 pt. 7,603
  7. Avatar for kvasirthewise 197. kvasirthewise Lv 1 1 pt. 7,406
  8. Avatar for inkycatz 198. inkycatz Lv 1 1 pt. 7,236
  9. Avatar for 01010011111 199. 01010011111 Lv 1 1 pt. 7,160
  10. Avatar for Falconfrog 200. Falconfrog Lv 1 1 pt. 4,802

Comments