Placeholder image of a protein
Icon representing a puzzle

1345: Revisiting Puzzle 89: Cow Eye

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
February 24, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein found at high concentrations of the lens of the eye; historically, this protein was purified from the eyes of B. taurus for research. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


TFRMRIYERDDFRGQMSEITDDCPSLQDRFHLTEVHSLNVLEGSWVLYEMPSYRGRQYLLRPGEYRRYLDWGAMNAKVGSLRRVMDFY

Top groups

  1. Avatar for Team South Africa 21. Team South Africa 1 pt. 8,672
  2. Avatar for xkcd 22. xkcd 1 pt. 8,664
  3. Avatar for BMB401_SP17 23. BMB401_SP17 1 pt. 8,436
  1. Avatar for freethought78 111. freethought78 Lv 1 2 pts. 9,131
  2. Avatar for DScott 112. DScott Lv 1 2 pts. 9,108
  3. Avatar for senor pit 113. senor pit Lv 1 2 pts. 9,092
  4. Avatar for Savas 114. Savas Lv 1 2 pts. 9,087
  5. Avatar for gu14013 115. gu14013 Lv 1 2 pts. 9,079
  6. Avatar for Psych0Active 116. Psych0Active Lv 1 2 pts. 9,063
  7. Avatar for leehaggis 117. leehaggis Lv 1 2 pts. 9,060
  8. Avatar for Simek 118. Simek Lv 1 2 pts. 9,049
  9. Avatar for rabamino12358 119. rabamino12358 Lv 1 2 pts. 8,984
  10. Avatar for goday_yashika 120. goday_yashika Lv 1 2 pts. 8,972

Comments