Placeholder image of a protein
Icon representing a puzzle

1345: Revisiting Puzzle 89: Cow Eye

Closed since about 9 years ago

Intermediate Overall Prediction

Summary


Created
February 24, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein found at high concentrations of the lens of the eye; historically, this protein was purified from the eyes of B. taurus for research. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


TFRMRIYERDDFRGQMSEITDDCPSLQDRFHLTEVHSLNVLEGSWVLYEMPSYRGRQYLLRPGEYRRYLDWGAMNAKVGSLRRVMDFY

Top groups


  1. Avatar for Team South Africa 21. Team South Africa 1 pt. 8,672
  2. Avatar for xkcd 22. xkcd 1 pt. 8,664
  3. Avatar for BMB401_SP17 23. BMB401_SP17 1 pt. 8,436

  1. Avatar for rinze 131. rinze Lv 1 1 pt. 8,853
  2. Avatar for pratt93 132. pratt93 Lv 1 1 pt. 8,838
  3. Avatar for EvilTwin 133. EvilTwin Lv 1 1 pt. 8,824
  4. Avatar for genevadHCC2017 134. genevadHCC2017 Lv 1 1 pt. 8,820
  5. Avatar for GU14110 135. GU14110 Lv 1 1 pt. 8,809
  6. Avatar for ManVsYard 136. ManVsYard Lv 1 1 pt. 8,791
  7. Avatar for leannerikicheever 137. leannerikicheever Lv 1 1 pt. 8,790
  8. Avatar for Lucas Family 138. Lucas Family Lv 1 1 pt. 8,781
  9. Avatar for gu14028 139. gu14028 Lv 1 1 pt. 8,778
  10. Avatar for lamoille 140. lamoille Lv 1 1 pt. 8,777

Comments