Placeholder image of a protein
Icon representing a puzzle

1345: Revisiting Puzzle 89: Cow Eye

Closed since about 9 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
February 24, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein found at high concentrations of the lens of the eye; historically, this protein was purified from the eyes of B. taurus for research. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


TFRMRIYERDDFRGQMSEITDDCPSLQDRFHLTEVHSLNVLEGSWVLYEMPSYRGRQYLLRPGEYRRYLDWGAMNAKVGSLRRVMDFY

Top groups


  1. Avatar for Team South Africa 21. Team South Africa 1 pt. 8,672
  2. Avatar for xkcd 22. xkcd 1 pt. 8,664
  3. Avatar for BMB401_SP17 23. BMB401_SP17 1 pt. 8,436

  1. Avatar for georg137 21. georg137 Lv 1 60 pts. 9,614
  2. Avatar for kabubi 22. kabubi Lv 1 58 pts. 9,613
  3. Avatar for eusair 23. eusair Lv 1 57 pts. 9,607
  4. Avatar for Fat Tony 24. Fat Tony Lv 1 55 pts. 9,602
  5. Avatar for smilingone 25. smilingone Lv 1 54 pts. 9,600
  6. Avatar for shettler 26. shettler Lv 1 52 pts. 9,599
  7. Avatar for tokens 27. tokens Lv 1 51 pts. 9,594
  8. Avatar for mimi 28. mimi Lv 1 49 pts. 9,593
  9. Avatar for pmdpmd 29. pmdpmd Lv 1 48 pts. 9,591
  10. Avatar for Jim Fraser 30. Jim Fraser Lv 1 47 pts. 9,578

Comments