Placeholder image of a protein
Icon representing a puzzle

1345: Revisiting Puzzle 89: Cow Eye

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
February 24, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein found at high concentrations of the lens of the eye; historically, this protein was purified from the eyes of B. taurus for research. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


TFRMRIYERDDFRGQMSEITDDCPSLQDRFHLTEVHSLNVLEGSWVLYEMPSYRGRQYLLRPGEYRRYLDWGAMNAKVGSLRRVMDFY

Top groups

  1. Avatar for Team South Africa 21. Team South Africa 1 pt. 8,672
  2. Avatar for xkcd 22. xkcd 1 pt. 8,664
  3. Avatar for BMB401_SP17 23. BMB401_SP17 1 pt. 8,436
  1. Avatar for JUMELLE54 81. JUMELLE54 Lv 1 9 pts. 9,348
  2. Avatar for alwen 82. alwen Lv 1 8 pts. 9,338
  3. Avatar for machinelves 83. machinelves Lv 1 8 pts. 9,336
  4. Avatar for jebbiek 84. jebbiek Lv 1 8 pts. 9,324
  5. Avatar for Mr_Jolty 85. Mr_Jolty Lv 1 7 pts. 9,315
  6. Avatar for joaniegirl 86. joaniegirl Lv 1 7 pts. 9,303
  7. Avatar for Keresto 87. Keresto Lv 1 7 pts. 9,286
  8. Avatar for guineapig 88. guineapig Lv 1 6 pts. 9,280
  9. Avatar for altejoh 89. altejoh Lv 1 6 pts. 9,280
  10. Avatar for SuperEnzyme 90. SuperEnzyme Lv 1 6 pts. 9,280

Comments