Placeholder image of a protein
Icon representing a puzzle

1345: Revisiting Puzzle 89: Cow Eye

Closed since about 9 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
February 24, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein found at high concentrations of the lens of the eye; historically, this protein was purified from the eyes of B. taurus for research. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


TFRMRIYERDDFRGQMSEITDDCPSLQDRFHLTEVHSLNVLEGSWVLYEMPSYRGRQYLLRPGEYRRYLDWGAMNAKVGSLRRVMDFY

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,691
  2. Avatar for Beta Folders 2. Beta Folders 80 pts. 9,662
  3. Avatar for Contenders 3. Contenders 63 pts. 9,660
  4. Avatar for Go Science 4. Go Science 49 pts. 9,657
  5. Avatar for Void Crushers 5. Void Crushers 37 pts. 9,656
  6. Avatar for HMT heritage 6. HMT heritage 28 pts. 9,644
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 21 pts. 9,636
  8. Avatar for Gargleblasters 8. Gargleblasters 15 pts. 9,617
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 11 pts. 9,449
  10. Avatar for :) 10. :) 8 pts. 9,336

  1. Avatar for Skippysk8s 91. Skippysk8s Lv 1 6 pts. 9,275
  2. Avatar for pandapharmd 92. pandapharmd Lv 1 6 pts. 9,267
  3. Avatar for jfryk 93. jfryk Lv 1 5 pts. 9,265
  4. Avatar for ViJay7019 94. ViJay7019 Lv 1 5 pts. 9,264
  5. Avatar for Hollinas 95. Hollinas Lv 1 5 pts. 9,257
  6. Avatar for rezaefar 96. rezaefar Lv 1 5 pts. 9,249
  7. Avatar for Arne Heessels 97. Arne Heessels Lv 1 4 pts. 9,245
  8. Avatar for SouperGenious 98. SouperGenious Lv 1 4 pts. 9,243
  9. Avatar for Merf 99. Merf Lv 1 4 pts. 9,240
  10. Avatar for Iron pet 100. Iron pet Lv 1 4 pts. 9,234

Comments