Placeholder image of a protein
Icon representing a puzzle

1345: Revisiting Puzzle 89: Cow Eye

Closed since about 9 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
February 24, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein found at high concentrations of the lens of the eye; historically, this protein was purified from the eyes of B. taurus for research. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


TFRMRIYERDDFRGQMSEITDDCPSLQDRFHLTEVHSLNVLEGSWVLYEMPSYRGRQYLLRPGEYRRYLDWGAMNAKVGSLRRVMDFY

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,691
  2. Avatar for Beta Folders 2. Beta Folders 80 pts. 9,662
  3. Avatar for Contenders 3. Contenders 63 pts. 9,660
  4. Avatar for Go Science 4. Go Science 49 pts. 9,657
  5. Avatar for Void Crushers 5. Void Crushers 37 pts. 9,656
  6. Avatar for HMT heritage 6. HMT heritage 28 pts. 9,644
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 21 pts. 9,636
  8. Avatar for Gargleblasters 8. Gargleblasters 15 pts. 9,617
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 11 pts. 9,449
  10. Avatar for :) 10. :) 8 pts. 9,336

  1. Avatar for lol3droflxp 151. lol3droflxp Lv 1 1 pt. 8,719
  2. Avatar for Nick_Flamel 152. Nick_Flamel Lv 1 1 pt. 8,718
  3. Avatar for NotJim99 153. NotJim99 Lv 1 1 pt. 8,706
  4. Avatar for gu14027 154. gu14027 Lv 1 1 pt. 8,704
  5. Avatar for gu14012 155. gu14012 Lv 1 1 pt. 8,701
  6. Avatar for gugit14026 156. gugit14026 Lv 1 1 pt. 8,694
  7. Avatar for MichelleRna 157. MichelleRna Lv 1 1 pt. 8,690
  8. Avatar for kacperwszolek 158. kacperwszolek Lv 1 1 pt. 8,688
  9. Avatar for doctaven 159. doctaven Lv 1 1 pt. 8,672
  10. Avatar for tweak64 160. tweak64 Lv 1 1 pt. 8,664

Comments