Placeholder image of a protein
Icon representing a puzzle

1345: Revisiting Puzzle 89: Cow Eye

Closed since about 9 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
February 24, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein found at high concentrations of the lens of the eye; historically, this protein was purified from the eyes of B. taurus for research. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


TFRMRIYERDDFRGQMSEITDDCPSLQDRFHLTEVHSLNVLEGSWVLYEMPSYRGRQYLLRPGEYRRYLDWGAMNAKVGSLRRVMDFY

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,691
  2. Avatar for Beta Folders 2. Beta Folders 80 pts. 9,662
  3. Avatar for Contenders 3. Contenders 63 pts. 9,660
  4. Avatar for Go Science 4. Go Science 49 pts. 9,657
  5. Avatar for Void Crushers 5. Void Crushers 37 pts. 9,656
  6. Avatar for HMT heritage 6. HMT heritage 28 pts. 9,644
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 21 pts. 9,636
  8. Avatar for Gargleblasters 8. Gargleblasters 15 pts. 9,617
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 11 pts. 9,449
  10. Avatar for :) 10. :) 8 pts. 9,336

  1. Avatar for ivalnic 171. ivalnic Lv 1 1 pt. 8,595
  2. Avatar for mcjaym 172. mcjaym Lv 1 1 pt. 8,577
  3. Avatar for navn 173. navn Lv 1 1 pt. 8,565
  4. Avatar for GamerForScience 174. GamerForScience Lv 1 1 pt. 8,558
  5. Avatar for fryguy 175. fryguy Lv 1 1 pt. 8,538
  6. Avatar for gaving1 176. gaving1 Lv 1 1 pt. 8,509
  7. Avatar for LusidLusin 177. LusidLusin Lv 1 1 pt. 8,503
  8. Avatar for Alekhya.vytla 178. Alekhya.vytla Lv 1 1 pt. 8,500
  9. Avatar for gu14021 179. gu14021 Lv 1 1 pt. 8,495
  10. Avatar for gu14017 180. gu14017 Lv 1 1 pt. 8,487

Comments