Placeholder image of a protein
Icon representing a puzzle

1347: Unsolved De-novo Freestyle 101: Exposed Hydrophobics

Closed since about 9 years ago

Intermediate Overall Prediction

Summary


Created
February 27, 2017
Expires
Max points
100
Description

This is a followup to Puzzle 1344. The score function for this puzzle has been adjusted to allow buried polar residues and exposed hydrophobics. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets! Players will be able to load in manual saves from Puzzle 1344 and use them as a starting point here.



Sequence:


MLQLLLAVFIGGGTGSVARWLLSMRFNPLHQAIPLGTLTANLIGAFIIGIGFAWFSRMTNIDPVWKVLITTGFCGGLTTFSTFSAEVVFLLQEGRFGWALLNVFVNLLGSFAMTALAFWLFSASTAH

Top groups


  1. Avatar for GUGITBIOTECH 11. GUGITBIOTECH 5 pts. 12,238
  2. Avatar for Deleted group 12. Deleted group pts. 12,177
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 2 pts. 12,144
  4. Avatar for Natural Abilities 14. Natural Abilities 2 pts. 12,142
  5. Avatar for :) 15. :) 1 pt. 12,071
  6. Avatar for Team South Africa 16. Team South Africa 1 pt. 11,693
  7. Avatar for BOINC@Poland 17. BOINC@Poland 1 pt. 11,027
  8. Avatar for HCC BIOL121 S2017 18. HCC BIOL121 S2017 1 pt. 10,953
  9. Avatar for LEC Metabolites 19. LEC Metabolites 1 pt. 9,836
  10. Avatar for Rice Biochemistry 20. Rice Biochemistry 1 pt. 8,683

  1. Avatar for Arne Heessels 111. Arne Heessels Lv 1 2 pts. 12,076
  2. Avatar for machinelves 112. machinelves Lv 1 2 pts. 12,071
  3. Avatar for tweak64 113. tweak64 Lv 1 2 pts. 12,059
  4. Avatar for dam_01 114. dam_01 Lv 1 2 pts. 12,055
  5. Avatar for gdnskye 115. gdnskye Lv 1 2 pts. 12,051
  6. Avatar for xavierhochart 116. xavierhochart Lv 1 2 pts. 12,051
  7. Avatar for dbuske 117. dbuske Lv 1 2 pts. 12,049
  8. Avatar for martinf 118. martinf Lv 1 1 pt. 12,036
  9. Avatar for frood66 119. frood66 Lv 1 1 pt. 12,029
  10. Avatar for RyeSnake 120. RyeSnake Lv 1 1 pt. 12,022

Comments