Placeholder image of a protein
Icon representing a puzzle

1347: Unsolved De-novo Freestyle 101: Exposed Hydrophobics

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
February 27, 2017
Expires
Max points
100
Description

This is a followup to Puzzle 1344. The score function for this puzzle has been adjusted to allow buried polar residues and exposed hydrophobics. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets! Players will be able to load in manual saves from Puzzle 1344 and use them as a starting point here.



Sequence:


MLQLLLAVFIGGGTGSVARWLLSMRFNPLHQAIPLGTLTANLIGAFIIGIGFAWFSRMTNIDPVWKVLITTGFCGGLTTFSTFSAEVVFLLQEGRFGWALLNVFVNLLGSFAMTALAFWLFSASTAH

Top groups

  1. Avatar for GUGITBIOTECH 11. GUGITBIOTECH 5 pts. 12,238
  2. Avatar for Deleted group 12. Deleted group pts. 12,177
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 2 pts. 12,144
  4. Avatar for Natural Abilities 14. Natural Abilities 2 pts. 12,142
  5. Avatar for :) 15. :) 1 pt. 12,071
  6. Avatar for Team South Africa 16. Team South Africa 1 pt. 11,693
  7. Avatar for BOINC@Poland 17. BOINC@Poland 1 pt. 11,027
  8. Avatar for HCC BIOL121 S2017 18. HCC BIOL121 S2017 1 pt. 10,953
  9. Avatar for LEC Metabolites 19. LEC Metabolites 1 pt. 9,836
  10. Avatar for Rice Biochemistry 20. Rice Biochemistry 1 pt. 8,683
  1. Avatar for Fat Tony 11. Fat Tony Lv 1 77 pts. 12,775
  2. Avatar for Scopper 12. Scopper Lv 1 75 pts. 12,767
  3. Avatar for Skippysk8s 13. Skippysk8s Lv 1 73 pts. 12,761
  4. Avatar for Formula350 14. Formula350 Lv 1 71 pts. 12,739
  5. Avatar for gitwut 15. gitwut Lv 1 69 pts. 12,738
  6. Avatar for Vinara 16. Vinara Lv 1 67 pts. 12,735
  7. Avatar for eusair 17. eusair Lv 1 66 pts. 12,730
  8. Avatar for guineapig 18. guineapig Lv 1 64 pts. 12,727
  9. Avatar for Timo van der Laan 19. Timo van der Laan Lv 1 62 pts. 12,726
  10. Avatar for Simek 20. Simek Lv 1 60 pts. 12,723

Comments