Placeholder image of a protein
Icon representing a puzzle

1347: Unsolved De-novo Freestyle 101: Exposed Hydrophobics

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
February 27, 2017
Expires
Max points
100
Description

This is a followup to Puzzle 1344. The score function for this puzzle has been adjusted to allow buried polar residues and exposed hydrophobics. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets! Players will be able to load in manual saves from Puzzle 1344 and use them as a starting point here.



Sequence:


MLQLLLAVFIGGGTGSVARWLLSMRFNPLHQAIPLGTLTANLIGAFIIGIGFAWFSRMTNIDPVWKVLITTGFCGGLTTFSTFSAEVVFLLQEGRFGWALLNVFVNLLGSFAMTALAFWLFSASTAH

Top groups

  1. Avatar for BMB401_SP17 21. BMB401_SP17 1 pt. 8,334
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 0
  3. Avatar for HMT heritage 23. HMT heritage 1 pt. 0
  1. Avatar for benrh 121. benrh Lv 1 1 pt. 11,924
  2. Avatar for Kiwegapa 122. Kiwegapa Lv 1 1 pt. 11,922
  3. Avatar for navn 123. navn Lv 1 1 pt. 11,920
  4. Avatar for andrewxc 124. andrewxc Lv 1 1 pt. 11,905
  5. Avatar for jbmkfm125 125. jbmkfm125 Lv 1 1 pt. 11,877
  6. Avatar for momadoc 126. momadoc Lv 1 1 pt. 11,875
  7. Avatar for andrewtmaxwell 127. andrewtmaxwell Lv 1 1 pt. 11,844
  8. Avatar for xt_hydra 128. xt_hydra Lv 1 1 pt. 11,812
  9. Avatar for Sellersburg 129. Sellersburg Lv 1 1 pt. 11,715
  10. Avatar for doctaven 130. doctaven Lv 1 1 pt. 11,693

Comments