Placeholder image of a protein
Icon representing a puzzle

1347: Unsolved De-novo Freestyle 101: Exposed Hydrophobics

Closed since about 9 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary

Created
February 27, 2017
Expires
Max points
100
Description

This is a followup to Puzzle 1344. The score function for this puzzle has been adjusted to allow buried polar residues and exposed hydrophobics. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets! Players will be able to load in manual saves from Puzzle 1344 and use them as a starting point here.



Sequence:


MLQLLLAVFIGGGTGSVARWLLSMRFNPLHQAIPLGTLTANLIGAFIIGIGFAWFSRMTNIDPVWKVLITTGFCGGLTTFSTFSAEVVFLLQEGRFGWALLNVFVNLLGSFAMTALAFWLFSASTAH

Top groups

  1. Avatar for BMB401_SP17 21. BMB401_SP17 1 pt. 8,334
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 0
  3. Avatar for HMT heritage 23. HMT heritage 1 pt. 0
  1. Avatar for jonniman 131. jonniman Lv 1 1 pt. 11,670
  2. Avatar for pooja chennupati 132. pooja chennupati Lv 1 1 pt. 11,551
  3. Avatar for uihcv 133. uihcv Lv 1 1 pt. 11,505
  4. Avatar for froggs554 134. froggs554 Lv 1 1 pt. 11,466
  5. Avatar for rinze 135. rinze Lv 1 1 pt. 11,342
  6. Avatar for karost 136. karost Lv 1 1 pt. 11,321
  7. Avatar for boondog 137. boondog Lv 1 1 pt. 11,248
  8. Avatar for AEJensen 138. AEJensen Lv 1 1 pt. 11,209
  9. Avatar for carinita 139. carinita Lv 1 1 pt. 11,194
  10. Avatar for maniek82 140. maniek82 Lv 1 1 pt. 11,027

Comments