Placeholder image of a protein
Icon representing a puzzle

1347: Unsolved De-novo Freestyle 101: Exposed Hydrophobics

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
February 27, 2017
Expires
Max points
100
Description

This is a followup to Puzzle 1344. The score function for this puzzle has been adjusted to allow buried polar residues and exposed hydrophobics. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets! Players will be able to load in manual saves from Puzzle 1344 and use them as a starting point here.



Sequence:


MLQLLLAVFIGGGTGSVARWLLSMRFNPLHQAIPLGTLTANLIGAFIIGIGFAWFSRMTNIDPVWKVLITTGFCGGLTTFSTFSAEVVFLLQEGRFGWALLNVFVNLLGSFAMTALAFWLFSASTAH

Top groups

  1. Avatar for BMB401_SP17 21. BMB401_SP17 1 pt. 8,334
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 0
  3. Avatar for HMT heritage 23. HMT heritage 1 pt. 0
  1. Avatar for CJ Mo 151. CJ Mo Lv 1 1 pt. 9,947
  2. Avatar for gu14021 152. gu14021 Lv 1 1 pt. 9,874
  3. Avatar for pratt93 153. pratt93 Lv 1 1 pt. 9,836
  4. Avatar for lamoille 154. lamoille Lv 1 1 pt. 9,793
  5. Avatar for gu1408 155. gu1408 Lv 1 1 pt. 9,654
  6. Avatar for DScott 156. DScott Lv 1 1 pt. 9,566
  7. Avatar for cnhrcolemam 157. cnhrcolemam Lv 1 1 pt. 9,513
  8. Avatar for pandapharmd 158. pandapharmd Lv 1 1 pt. 9,378
  9. Avatar for Nanameko 159. Nanameko Lv 1 1 pt. 9,320
  10. Avatar for Fernando Silveira 160. Fernando Silveira Lv 1 1 pt. 9,280

Comments