Placeholder image of a protein
Icon representing a puzzle

1347: Unsolved De-novo Freestyle 101: Exposed Hydrophobics

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
February 27, 2017
Expires
Max points
100
Description

This is a followup to Puzzle 1344. The score function for this puzzle has been adjusted to allow buried polar residues and exposed hydrophobics. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets! Players will be able to load in manual saves from Puzzle 1344 and use them as a starting point here.



Sequence:


MLQLLLAVFIGGGTGSVARWLLSMRFNPLHQAIPLGTLTANLIGAFIIGIGFAWFSRMTNIDPVWKVLITTGFCGGLTTFSTFSAEVVFLLQEGRFGWALLNVFVNLLGSFAMTALAFWLFSASTAH

Top groups

  1. Avatar for BMB401_SP17 21. BMB401_SP17 1 pt. 8,334
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 0
  3. Avatar for HMT heritage 23. HMT heritage 1 pt. 0
  1. Avatar for fiendish_ghoul 21. fiendish_ghoul Lv 1 59 pts. 12,704
  2. Avatar for ZeroLeak7 22. ZeroLeak7 Lv 1 57 pts. 12,699
  3. Avatar for LociOiling 23. LociOiling Lv 1 55 pts. 12,698
  4. Avatar for caglar 24. caglar Lv 1 54 pts. 12,694
  5. Avatar for NinjaGreg 25. NinjaGreg Lv 1 52 pts. 12,692
  6. Avatar for nicobul 26. nicobul Lv 1 51 pts. 12,683
  7. Avatar for Galaxie 27. Galaxie Lv 1 49 pts. 12,682
  8. Avatar for hansvandenhof 28. hansvandenhof Lv 1 48 pts. 12,670
  9. Avatar for Vredeman 29. Vredeman Lv 1 46 pts. 12,665
  10. Avatar for christioanchauvin 30. christioanchauvin Lv 1 45 pts. 12,654

Comments