Placeholder image of a protein
Icon representing a puzzle

1347: Unsolved De-novo Freestyle 101: Exposed Hydrophobics

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
February 27, 2017
Expires
Max points
100
Description

This is a followup to Puzzle 1344. The score function for this puzzle has been adjusted to allow buried polar residues and exposed hydrophobics. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets! Players will be able to load in manual saves from Puzzle 1344 and use them as a starting point here.



Sequence:


MLQLLLAVFIGGGTGSVARWLLSMRFNPLHQAIPLGTLTANLIGAFIIGIGFAWFSRMTNIDPVWKVLITTGFCGGLTTFSTFSAEVVFLLQEGRFGWALLNVFVNLLGSFAMTALAFWLFSASTAH

Top groups

  1. Avatar for BMB401_SP17 21. BMB401_SP17 1 pt. 8,334
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 0
  3. Avatar for HMT heritage 23. HMT heritage 1 pt. 0
  1. Avatar for spvincent 41. spvincent Lv 1 32 pts. 12,570
  2. Avatar for shettler 42. shettler Lv 1 31 pts. 12,567
  3. Avatar for WBarme1234 43. WBarme1234 Lv 1 30 pts. 12,563
  4. Avatar for tarimo 44. tarimo Lv 1 29 pts. 12,553
  5. Avatar for heather-1 45. heather-1 Lv 1 28 pts. 12,547
  6. Avatar for JayD7217 46. JayD7217 Lv 1 27 pts. 12,541
  7. Avatar for Glen B 47. Glen B Lv 1 26 pts. 12,526
  8. Avatar for Crossed Sticks 48. Crossed Sticks Lv 1 25 pts. 12,514
  9. Avatar for pvc78 49. pvc78 Lv 1 25 pts. 12,510
  10. Avatar for weitzen 50. weitzen Lv 1 24 pts. 12,503

Comments