Placeholder image of a protein
Icon representing a puzzle

1347: Unsolved De-novo Freestyle 101: Exposed Hydrophobics

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
February 27, 2017
Expires
Max points
100
Description

This is a followup to Puzzle 1344. The score function for this puzzle has been adjusted to allow buried polar residues and exposed hydrophobics. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets! Players will be able to load in manual saves from Puzzle 1344 and use them as a starting point here.



Sequence:


MLQLLLAVFIGGGTGSVARWLLSMRFNPLHQAIPLGTLTANLIGAFIIGIGFAWFSRMTNIDPVWKVLITTGFCGGLTTFSTFSAEVVFLLQEGRFGWALLNVFVNLLGSFAMTALAFWLFSASTAH

Top groups

  1. Avatar for BMB401_SP17 21. BMB401_SP17 1 pt. 8,334
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 0
  3. Avatar for HMT heritage 23. HMT heritage 1 pt. 0
  1. Avatar for Anfinsen_slept_here 51. Anfinsen_slept_here Lv 1 23 pts. 12,499
  2. Avatar for kabubi 52. kabubi Lv 1 22 pts. 12,496
  3. Avatar for Deleted player 53. Deleted player pts. 12,492
  4. Avatar for hpaege 54. hpaege Lv 1 21 pts. 12,487
  5. Avatar for Alistair69 55. Alistair69 Lv 1 20 pts. 12,482
  6. Avatar for georg137 56. georg137 Lv 1 19 pts. 12,481
  7. Avatar for Blipperman 57. Blipperman Lv 1 19 pts. 12,467
  8. Avatar for freethought78 58. freethought78 Lv 1 18 pts. 12,458
  9. Avatar for randomlil 59. randomlil Lv 1 17 pts. 12,441
  10. Avatar for deLaCeiba 60. deLaCeiba Lv 1 17 pts. 12,438

Comments