Placeholder image of a protein
Icon representing a puzzle

1347: Unsolved De-novo Freestyle 101: Exposed Hydrophobics

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
February 27, 2017
Expires
Max points
100
Description

This is a followup to Puzzle 1344. The score function for this puzzle has been adjusted to allow buried polar residues and exposed hydrophobics. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets! Players will be able to load in manual saves from Puzzle 1344 and use them as a starting point here.



Sequence:


MLQLLLAVFIGGGTGSVARWLLSMRFNPLHQAIPLGTLTANLIGAFIIGIGFAWFSRMTNIDPVWKVLITTGFCGGLTTFSTFSAEVVFLLQEGRFGWALLNVFVNLLGSFAMTALAFWLFSASTAH

Top groups

  1. Avatar for BMB401_SP17 21. BMB401_SP17 1 pt. 8,334
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 0
  3. Avatar for HMT heritage 23. HMT heritage 1 pt. 0
  1. Avatar for katling 61. katling Lv 1 16 pts. 12,424
  2. Avatar for dssb 62. dssb Lv 1 16 pts. 12,409
  3. Avatar for jobo0502 63. jobo0502 Lv 1 15 pts. 12,405
  4. Avatar for smholst 64. smholst Lv 1 15 pts. 12,395
  5. Avatar for Bletchley Park 65. Bletchley Park Lv 1 14 pts. 12,393
  6. Avatar for philcalhoun 66. philcalhoun Lv 1 13 pts. 12,388
  7. Avatar for justjustin 67. justjustin Lv 1 13 pts. 12,364
  8. Avatar for MicElephant 68. MicElephant Lv 1 13 pts. 12,359
  9. Avatar for AeonFluff 69. AeonFluff Lv 1 12 pts. 12,359
  10. Avatar for Tehnologik1 70. Tehnologik1 Lv 1 12 pts. 12,349

Comments