Placeholder image of a protein
Icon representing a puzzle

1347: Unsolved De-novo Freestyle 101: Exposed Hydrophobics

Closed since about 9 years ago

Intermediate Overall Prediction

Summary


Created
February 27, 2017
Expires
Max points
100
Description

This is a followup to Puzzle 1344. The score function for this puzzle has been adjusted to allow buried polar residues and exposed hydrophobics. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets! Players will be able to load in manual saves from Puzzle 1344 and use them as a starting point here.



Sequence:


MLQLLLAVFIGGGTGSVARWLLSMRFNPLHQAIPLGTLTANLIGAFIIGIGFAWFSRMTNIDPVWKVLITTGFCGGLTTFSTFSAEVVFLLQEGRFGWALLNVFVNLLGSFAMTALAFWLFSASTAH

Top groups


  1. Avatar for BMB401_SP17 21. BMB401_SP17 1 pt. 8,334
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 0
  3. Avatar for HMT heritage 23. HMT heritage 1 pt. 0

  1. Avatar for alwen 81. alwen Lv 1 8 pts. 12,307
  2. Avatar for Deleted player 82. Deleted player pts. 12,306
  3. Avatar for Bushman 83. Bushman Lv 1 7 pts. 12,306
  4. Avatar for SKSbell 84. SKSbell Lv 1 7 pts. 12,303
  5. Avatar for Merf 85. Merf Lv 1 6 pts. 12,296
  6. Avatar for alcor29 86. alcor29 Lv 1 6 pts. 12,293
  7. Avatar for smilingone 87. smilingone Lv 1 6 pts. 12,282
  8. Avatar for senor pit 88. senor pit Lv 1 6 pts. 12,251
  9. Avatar for leehaggis 89. leehaggis Lv 1 5 pts. 12,250
  10. Avatar for lupussapien 90. lupussapien Lv 1 5 pts. 12,249

Comments