Placeholder image of a protein
Icon representing a puzzle

1347: Unsolved De-novo Freestyle 101: Exposed Hydrophobics

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
February 27, 2017
Expires
Max points
100
Description

This is a followup to Puzzle 1344. The score function for this puzzle has been adjusted to allow buried polar residues and exposed hydrophobics. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets! Players will be able to load in manual saves from Puzzle 1344 and use them as a starting point here.



Sequence:


MLQLLLAVFIGGGTGSVARWLLSMRFNPLHQAIPLGTLTANLIGAFIIGIGFAWFSRMTNIDPVWKVLITTGFCGGLTTFSTFSAEVVFLLQEGRFGWALLNVFVNLLGSFAMTALAFWLFSASTAH

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 12,881
  2. Avatar for Beta Folders 2. Beta Folders 80 pts. 12,880
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 63 pts. 12,880
  4. Avatar for Gargleblasters 4. Gargleblasters 49 pts. 12,776
  5. Avatar for Contenders 5. Contenders 37 pts. 12,738
  6. Avatar for Void Crushers 6. Void Crushers 28 pts. 12,726
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 21 pts. 12,683
  8. Avatar for xkcd 8. xkcd 15 pts. 12,601
  9. Avatar for Deleted group 9. Deleted group pts. 12,458
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 8 pts. 12,438
  1. Avatar for alwen 11. alwen Lv 1 19 pts. 12,818
  2. Avatar for phi16 12. phi16 Lv 1 16 pts. 12,803
  3. Avatar for alcor29 13. alcor29 Lv 1 13 pts. 12,791
  4. Avatar for smholst 14. smholst Lv 1 10 pts. 12,772
  5. Avatar for Skippysk8s 15. Skippysk8s Lv 1 8 pts. 12,769
  6. Avatar for ManVsYard 16. ManVsYard Lv 1 7 pts. 12,768
  7. Avatar for actiasluna 17. actiasluna Lv 1 5 pts. 12,760
  8. Avatar for gitwut 18. gitwut Lv 1 4 pts. 12,738
  9. Avatar for georg137 19. georg137 Lv 1 3 pts. 12,735
  10. Avatar for Bletchley Park 20. Bletchley Park Lv 1 2 pts. 12,735

Comments