Placeholder image of a protein
Icon representing a puzzle

1347: Unsolved De-novo Freestyle 101: Exposed Hydrophobics

Closed since about 9 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
February 27, 2017
Expires
Max points
100
Description

This is a followup to Puzzle 1344. The score function for this puzzle has been adjusted to allow buried polar residues and exposed hydrophobics. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets! Players will be able to load in manual saves from Puzzle 1344 and use them as a starting point here.



Sequence:


MLQLLLAVFIGGGTGSVARWLLSMRFNPLHQAIPLGTLTANLIGAFIIGIGFAWFSRMTNIDPVWKVLITTGFCGGLTTFSTFSAEVVFLLQEGRFGWALLNVFVNLLGSFAMTALAFWLFSASTAH

Top groups


  1. Avatar for Go Science 100 pts. 12,881
  2. Avatar for Beta Folders 2. Beta Folders 80 pts. 12,880
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 63 pts. 12,880
  4. Avatar for Gargleblasters 4. Gargleblasters 49 pts. 12,776
  5. Avatar for Contenders 5. Contenders 37 pts. 12,738
  6. Avatar for Void Crushers 6. Void Crushers 28 pts. 12,726
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 21 pts. 12,683
  8. Avatar for xkcd 8. xkcd 15 pts. 12,601
  9. Avatar for Deleted group 9. Deleted group pts. 12,458
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 8 pts. 12,438

  1. Avatar for mitarcher 101. mitarcher Lv 1 3 pts. 12,165
  2. Avatar for stomjoh 102. stomjoh Lv 1 3 pts. 12,165
  3. Avatar for FishKAA 103. FishKAA Lv 1 3 pts. 12,156
  4. Avatar for leannerikicheever 104. leannerikicheever Lv 1 3 pts. 12,156
  5. Avatar for Savas 105. Savas Lv 1 3 pts. 12,144
  6. Avatar for Mr_Jolty 106. Mr_Jolty Lv 1 3 pts. 12,142
  7. Avatar for SaraL 107. SaraL Lv 1 2 pts. 12,139
  8. Avatar for Cerzax 108. Cerzax Lv 1 2 pts. 12,123
  9. Avatar for rabamino12358 109. rabamino12358 Lv 1 2 pts. 12,114
  10. Avatar for goday_yashika 110. goday_yashika Lv 1 2 pts. 12,096

Comments