Placeholder image of a protein
Icon representing a puzzle

1347: Unsolved De-novo Freestyle 101: Exposed Hydrophobics

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
February 27, 2017
Expires
Max points
100
Description

This is a followup to Puzzle 1344. The score function for this puzzle has been adjusted to allow buried polar residues and exposed hydrophobics. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets! Players will be able to load in manual saves from Puzzle 1344 and use them as a starting point here.



Sequence:


MLQLLLAVFIGGGTGSVARWLLSMRFNPLHQAIPLGTLTANLIGAFIIGIGFAWFSRMTNIDPVWKVLITTGFCGGLTTFSTFSAEVVFLLQEGRFGWALLNVFVNLLGSFAMTALAFWLFSASTAH

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 12,881
  2. Avatar for Beta Folders 2. Beta Folders 80 pts. 12,880
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 63 pts. 12,880
  4. Avatar for Gargleblasters 4. Gargleblasters 49 pts. 12,776
  5. Avatar for Contenders 5. Contenders 37 pts. 12,738
  6. Avatar for Void Crushers 6. Void Crushers 28 pts. 12,726
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 21 pts. 12,683
  8. Avatar for xkcd 8. xkcd 15 pts. 12,601
  9. Avatar for Deleted group 9. Deleted group pts. 12,458
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 8 pts. 12,438
  1. Avatar for gu14003 91. gu14003 Lv 1 5 pts. 12,238
  2. Avatar for ViJay7019 92. ViJay7019 Lv 1 5 pts. 12,233
  3. Avatar for snakeguy 93. snakeguy Lv 1 5 pts. 12,230
  4. Avatar for YeshuaLives 94. YeshuaLives Lv 1 4 pts. 12,211
  5. Avatar for rezaefar 95. rezaefar Lv 1 4 pts. 12,206
  6. Avatar for JUMELLE54 96. JUMELLE54 Lv 1 4 pts. 12,202
  7. Avatar for drumpeter18yrs9yrs 97. drumpeter18yrs9yrs Lv 1 4 pts. 12,177
  8. Avatar for SouperGenious 98. SouperGenious Lv 1 4 pts. 12,175
  9. Avatar for harvardman 99. harvardman Lv 1 3 pts. 12,167
  10. Avatar for YGK 100. YGK Lv 1 3 pts. 12,166

Comments