1347: Unsolved De-novo Freestyle 101: Exposed Hydrophobics

Closed since about 9 years ago

Summary

• Created: February 27, 2017
• Expires: March 06, 2017 at 23:00 UTC
• Max points: 100

Description

This is a followup to Puzzle 1344. The score function for this puzzle has been adjusted to allow buried polar residues and exposed hydrophobics. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets! Players will be able to load in manual saves from Puzzle 1344 and use them as a starting point here.



Sequence:

MLQLLLAVFIGGGTGSVARWLLSMRFNPLHQAIPLGTLTANLIGAFIIGIGFAWFSRMTNIDPVWKVLITTGFCGGLTTFSTFSAEVVFLLQEGRFGWALLNVFVNLLGSFAMTALAFWLFSASTAH

Top groups

• 1. Go Science 100 pts. 12,881
• 2. Beta Folders 80 pts. 12,880
• 3. Anthropic Dreams 63 pts. 12,880
• 4. Gargleblasters 49 pts. 12,776
• 5. Contenders 37 pts. 12,738
• 6. Void Crushers 28 pts. 12,726
• 7. L'Alliance Francophone 21 pts. 12,683
• 8. xkcd 15 pts. 12,601
• 9. Deleted group pts. 12,458
• 10. Italiani Al Lavoro 8 pts. 12,438

Top soloists

• 31. pmdpmd 44 pts. 12,647
• 32. Bruno Kestemont 42 pts. 12,641
• 33. mimi 41 pts. 12,623
• 34. diamonddays 40 pts. 12,623
• 35. Mike Cassidy 39 pts. 12,622
• 36. TastyMunchies 37 pts. 12,613
• 37. fishercat 36 pts. 12,607
• 38. fryguy 35 pts. 12,601
• 39. Threeoak 34 pts. 12,591
• 40. dcrwheeler 33 pts. 12,571