Placeholder image of a protein
Icon representing a puzzle

1348: Revisiting Puzzle 89 with Density: Cow Eye

Closed since about 9 years ago

Intermediate Overall Prediction Electron Density

Summary


Created
March 04, 2017
Expires
Max points
100
Description

This is a repost of Puzzle 1345, now with an electron density map! This small domain is part of a larger protein found at high concentrations of the lens of the eye; historically, this protein was purified from the eyes of B. taurus for research. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players may load in solutions from Puzzle 1345.



Sequence:


TFRMRIYERDDFRGQMSEITDDCPSLQDRFHLTEVHSLNVLEGSWVLYEMPSYRGRQYLLRPGEYRRYLDWGAMNAKVGSLRRVMDFY

Top groups


  1. Avatar for Natural Abilities 11. Natural Abilities 2 pts. 9,835
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 9,699
  3. Avatar for SciOne2017 13. SciOne2017 1 pt. 9,536
  4. Avatar for xkcd 14. xkcd 1 pt. 9,255
  5. Avatar for freefolder 15. freefolder 1 pt. 8,989
  6. Avatar for GUGITBIOTECH 16. GUGITBIOTECH 1 pt. 8,916
  7. Avatar for BOINC@Poland 17. BOINC@Poland 1 pt. 8,908
  8. Avatar for Deleted group 18. Deleted group pts. 0

  1. Avatar for pauldunn 11. pauldunn Lv 1 74 pts. 14,987
  2. Avatar for LociOiling 12. LociOiling Lv 1 71 pts. 14,985
  3. Avatar for dcrwheeler 13. dcrwheeler Lv 1 69 pts. 14,981
  4. Avatar for gitwut 14. gitwut Lv 1 67 pts. 14,979
  5. Avatar for actiasluna 15. actiasluna Lv 1 65 pts. 14,978
  6. Avatar for shettler 16. shettler Lv 1 62 pts. 14,977
  7. Avatar for tokens 17. tokens Lv 1 60 pts. 14,977
  8. Avatar for Timo van der Laan 18. Timo van der Laan Lv 1 58 pts. 14,962
  9. Avatar for jermainiac 19. jermainiac Lv 1 56 pts. 14,954
  10. Avatar for johnmitch 20. johnmitch Lv 1 55 pts. 14,950

Comments