Placeholder image of a protein
Icon representing a puzzle

1348: Revisiting Puzzle 89 with Density: Cow Eye

Closed since about 9 years ago

Intermediate Overall Prediction Electron Density

Summary


Created
March 04, 2017
Expires
Max points
100
Description

This is a repost of Puzzle 1345, now with an electron density map! This small domain is part of a larger protein found at high concentrations of the lens of the eye; historically, this protein was purified from the eyes of B. taurus for research. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players may load in solutions from Puzzle 1345.



Sequence:


TFRMRIYERDDFRGQMSEITDDCPSLQDRFHLTEVHSLNVLEGSWVLYEMPSYRGRQYLLRPGEYRRYLDWGAMNAKVGSLRRVMDFY

Top groups


  1. Avatar for Beta Folders 100 pts. 15,020
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 15,018
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 54 pts. 15,016
  4. Avatar for Go Science 4. Go Science 38 pts. 15,007
  5. Avatar for Contenders 5. Contenders 27 pts. 15,002
  6. Avatar for Gargleblasters 6. Gargleblasters 18 pts. 14,978
  7. Avatar for Void Crushers 7. Void Crushers 12 pts. 14,962
  8. Avatar for Italiani Al Lavoro 8. Italiani Al Lavoro 8 pts. 12,314
  9. Avatar for Team Schleswig-Holstein 9. Team Schleswig-Holstein 5 pts. 11,182
  10. Avatar for HMT heritage 10. HMT heritage 3 pts. 10,311

  1. Avatar for gaving1 141. gaving1 Lv 1 1 pt. 8,519
  2. Avatar for carinita 142. carinita Lv 1 1 pt. 8,506
  3. Avatar for jbmkfm125 143. jbmkfm125 Lv 1 1 pt. 8,460
  4. Avatar for zayna_27 144. zayna_27 Lv 1 1 pt. 8,435
  5. Avatar for Alekhya.vytla 145. Alekhya.vytla Lv 1 1 pt. 8,418
  6. Avatar for Blitzghost 146. Blitzghost Lv 1 1 pt. 8,391
  7. Avatar for Deleted player 147. Deleted player pts. 8,344
  8. Avatar for Ellis Arimitsu 148. Ellis Arimitsu Lv 1 1 pt. 8,284
  9. Avatar for Epigenetics 149. Epigenetics Lv 1 1 pt. 7,935
  10. Avatar for 01010011111 150. 01010011111 Lv 1 1 pt. 7,903

Comments