1348: Revisiting Puzzle 89 with Density: Cow Eye

Closed since about 9 years ago

Summary

• Created: March 04, 2017
• Expires: March 10, 2017 at 18:00 UTC
• Max points: 100

Description

This is a repost of Puzzle 1345, now with an electron density map! This small domain is part of a larger protein found at high concentrations of the lens of the eye; historically, this protein was purified from the eyes of B. taurus for research. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players may load in solutions from Puzzle 1345.



Sequence:

TFRMRIYERDDFRGQMSEITDDCPSLQDRFHLTEVHSLNVLEGSWVLYEMPSYRGRQYLLRPGEYRRYLDWGAMNAKVGSLRRVMDFY

Top groups

• 1. Beta Folders 100 pts. 15,020
• 2. Anthropic Dreams 74 pts. 15,018
• 3. L'Alliance Francophone 54 pts. 15,016
• 4. Go Science 38 pts. 15,007
• 5. Contenders 27 pts. 15,002
• 6. Gargleblasters 18 pts. 14,978
• 7. Void Crushers 12 pts. 14,962
• 8. Italiani Al Lavoro 8 pts. 12,314
• 9. Team Schleswig-Holstein 5 pts. 11,182
• 10. HMT heritage 3 pts. 10,311

Top soloists

• 81. Skippysk8s 4 pts. 9,980
• 82. edejoya 4 pts. 9,887
• 83. rezaefar 4 pts. 9,877
• 84. Mr_Jolty 3 pts. 9,835
• 85. joaniegirl 3 pts. 9,793
• 86. phi16 3 pts. 9,769
• 87. Mike Cassidy 3 pts. 9,767
• 88. JUMELLE54 3 pts. 9,749
• 89. mitarcher 3 pts. 9,734
• 90. Merf 3 pts. 9,708