Placeholder image of a protein
Icon representing a puzzle

1350: Unsolved De-novo Freestyle 101: Predicted Contacts

Closed since about 9 years ago

Intermediate Overall Prediction Predicted Contacts

Summary


Created
March 06, 2017
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1347, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzles 1344 and 1347 and use them as a starting point here.



Sequence:


MLQLLLAVFIGGGTGSVARWLLSMRFNPLHQAIPLGTLTANLIGAFIIGIGFAWFSRMTNIDPVWKVLITTGFCGGLTTFSTFSAEVVFLLQEGRFGWALLNVFVNLLGSFAMTALAFWLFSASTAH

Top groups


  1. Avatar for GUGITBIOTECH 11. GUGITBIOTECH 4 pts. 14,703
  2. Avatar for Deleted group 12. Deleted group pts. 14,699
  3. Avatar for freefolder 13. freefolder 2 pts. 14,656
  4. Avatar for Natural Abilities 15. Natural Abilities 1 pt. 14,501
  5. Avatar for LEC Metabolites 16. LEC Metabolites 1 pt. 13,509
  6. Avatar for Team South Africa 17. Team South Africa 1 pt. 12,410
  7. Avatar for Team Schleswig-Holstein 18. Team Schleswig-Holstein 1 pt. 12,169
  8. Avatar for BOINC@Poland 19. BOINC@Poland 1 pt. 10,622
  9. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 8,750

  1. Avatar for jermainiac
    1. jermainiac Lv 1
    100 pts. 17,629
  2. Avatar for Galaxie 2. Galaxie Lv 1 88 pts. 17,626
  3. Avatar for Bruno Kestemont 3. Bruno Kestemont Lv 1 76 pts. 17,619
  4. Avatar for Deleted player 4. Deleted player pts. 17,586
  5. Avatar for lamoille 5. lamoille Lv 1 57 pts. 17,545
  6. Avatar for tokens 6. tokens Lv 1 49 pts. 17,537
  7. Avatar for alcor29 7. alcor29 Lv 1 42 pts. 17,525
  8. Avatar for Deleted player 8. Deleted player pts. 17,488
  9. Avatar for smilingone 9. smilingone Lv 1 30 pts. 17,344
  10. Avatar for LociOiling 10. LociOiling Lv 1 25 pts. 17,340

Comments