Placeholder image of a protein
Icon representing a puzzle

1350: Unsolved De-novo Freestyle 101: Predicted Contacts

Closed since about 9 years ago

Intermediate Overall Prediction Predicted Contacts

Summary


Created
March 06, 2017
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1347, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzles 1344 and 1347 and use them as a starting point here.



Sequence:


MLQLLLAVFIGGGTGSVARWLLSMRFNPLHQAIPLGTLTANLIGAFIIGIGFAWFSRMTNIDPVWKVLITTGFCGGLTTFSTFSAEVVFLLQEGRFGWALLNVFVNLLGSFAMTALAFWLFSASTAH

Top groups


  1. Avatar for GUGITBIOTECH 11. GUGITBIOTECH 4 pts. 14,703
  2. Avatar for Deleted group 12. Deleted group pts. 14,699
  3. Avatar for freefolder 13. freefolder 2 pts. 14,656
  4. Avatar for Natural Abilities 15. Natural Abilities 1 pt. 14,501
  5. Avatar for LEC Metabolites 16. LEC Metabolites 1 pt. 13,509
  6. Avatar for Team South Africa 17. Team South Africa 1 pt. 12,410
  7. Avatar for Team Schleswig-Holstein 18. Team Schleswig-Holstein 1 pt. 12,169
  8. Avatar for BOINC@Poland 19. BOINC@Poland 1 pt. 10,622
  9. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 8,750

  1. Avatar for 1210115146 111. 1210115146 Lv 1 1 pt. 14,345
  2. Avatar for andrewtmaxwell 112. andrewtmaxwell Lv 1 1 pt. 14,337
  3. Avatar for Cerzax 113. Cerzax Lv 1 1 pt. 14,320
  4. Avatar for saksoft2 114. saksoft2 Lv 1 1 pt. 14,256
  5. Avatar for Kiwegapa 115. Kiwegapa Lv 1 1 pt. 14,223
  6. Avatar for benrh 116. benrh Lv 1 1 pt. 14,203
  7. Avatar for Fog Darts 117. Fog Darts Lv 1 1 pt. 14,199
  8. Avatar for navn 118. navn Lv 1 1 pt. 14,169
  9. Avatar for jbmkfm125 119. jbmkfm125 Lv 1 1 pt. 14,157
  10. Avatar for carinita 120. carinita Lv 1 1 pt. 14,078

Comments