Placeholder image of a protein
Icon representing a puzzle

1350: Unsolved De-novo Freestyle 101: Predicted Contacts

Closed since about 9 years ago

Intermediate Overall Prediction Predicted Contacts

Summary


Created
March 06, 2017
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1347, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzles 1344 and 1347 and use them as a starting point here.



Sequence:


MLQLLLAVFIGGGTGSVARWLLSMRFNPLHQAIPLGTLTANLIGAFIIGIGFAWFSRMTNIDPVWKVLITTGFCGGLTTFSTFSAEVVFLLQEGRFGWALLNVFVNLLGSFAMTALAFWLFSASTAH

Top groups


  1. Avatar for BIO257C 21. BIO257C 1 pt. 8,324

  1. Avatar for Astralist 161. Astralist Lv 1 1 pt. 8,248
  2. Avatar for seba6029 162. seba6029 Lv 1 1 pt. 8,048
  3. Avatar for edgarl 163. edgarl Lv 1 1 pt. 7,747
  4. Avatar for OmidBall777 164. OmidBall777 Lv 1 1 pt. 7,733
  5. Avatar for JayD7217 165. JayD7217 Lv 1 1 pt. 7,287
  6. Avatar for starflight 166. starflight Lv 1 1 pt. 7,197
  7. Avatar for 17willa 167. 17willa Lv 1 1 pt. 4,301
  8. Avatar for bar_roma 168. bar_roma Lv 1 1 pt. 0
  9. Avatar for Bautho 170. Bautho Lv 1 1 pt. 0

Comments