Placeholder image of a protein
Icon representing a puzzle

1350: Unsolved De-novo Freestyle 101: Predicted Contacts

Closed since about 9 years ago

Intermediate Overall Prediction Predicted Contacts

Summary


Created
March 06, 2017
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1347, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzles 1344 and 1347 and use them as a starting point here.



Sequence:


MLQLLLAVFIGGGTGSVARWLLSMRFNPLHQAIPLGTLTANLIGAFIIGIGFAWFSRMTNIDPVWKVLITTGFCGGLTTFSTFSAEVVFLLQEGRFGWALLNVFVNLLGSFAMTALAFWLFSASTAH

Top groups


  1. Avatar for BIO257C 21. BIO257C 1 pt. 8,324

  1. Avatar for jermainiac 31. jermainiac Lv 1 40 pts. 15,726
  2. Avatar for christioanchauvin 32. christioanchauvin Lv 1 38 pts. 15,721
  3. Avatar for TastyMunchies 33. TastyMunchies Lv 1 37 pts. 15,667
  4. Avatar for katling 34. katling Lv 1 36 pts. 15,665
  5. Avatar for eusair 35. eusair Lv 1 34 pts. 15,629
  6. Avatar for gitwut 36. gitwut Lv 1 33 pts. 15,599
  7. Avatar for dcrwheeler 37. dcrwheeler Lv 1 32 pts. 15,591
  8. Avatar for pauldunn 38. pauldunn Lv 1 31 pts. 15,576
  9. Avatar for pvc78 39. pvc78 Lv 1 30 pts. 15,556
  10. Avatar for mimi 40. mimi Lv 1 29 pts. 15,549

Comments