Placeholder image of a protein
Icon representing a puzzle

1350: Unsolved De-novo Freestyle 101: Predicted Contacts

Closed since about 9 years ago

Intermediate Overall Prediction Predicted Contacts

Summary


Created
March 06, 2017
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1347, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzles 1344 and 1347 and use them as a starting point here.



Sequence:


MLQLLLAVFIGGGTGSVARWLLSMRFNPLHQAIPLGTLTANLIGAFIIGIGFAWFSRMTNIDPVWKVLITTGFCGGLTTFSTFSAEVVFLLQEGRFGWALLNVFVNLLGSFAMTALAFWLFSASTAH

Top groups


  1. Avatar for BIO257C 21. BIO257C 1 pt. 8,324

  1. Avatar for crpainter 41. crpainter Lv 1 28 pts. 15,537
  2. Avatar for MurloW 42. MurloW Lv 1 27 pts. 15,527
  3. Avatar for Deleted player 43. Deleted player pts. 15,511
  4. Avatar for jobo0502 44. jobo0502 Lv 1 25 pts. 15,502
  5. Avatar for fishercat 45. fishercat Lv 1 24 pts. 15,478
  6. Avatar for Bushman 46. Bushman Lv 1 23 pts. 15,447
  7. Avatar for heather-1 47. heather-1 Lv 1 22 pts. 15,429
  8. Avatar for guineapig 48. guineapig Lv 1 21 pts. 15,423
  9. Avatar for Museka 49. Museka Lv 1 21 pts. 15,402
  10. Avatar for diamonddays 50. diamonddays Lv 1 20 pts. 15,352

Comments