Placeholder image of a protein
Icon representing a puzzle

1350: Unsolved De-novo Freestyle 101: Predicted Contacts

Closed since about 9 years ago

Intermediate Intermediate Overall Overall Prediction Prediction Predicted Contacts Predicted Contacts

Summary

Created
March 06, 2017
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1347, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzles 1344 and 1347 and use them as a starting point here.



Sequence:


MLQLLLAVFIGGGTGSVARWLLSMRFNPLHQAIPLGTLTANLIGAFIIGIGFAWFSRMTNIDPVWKVLITTGFCGGLTTFSTFSAEVVFLLQEGRFGWALLNVFVNLLGSFAMTALAFWLFSASTAH

Top groups

  1. Avatar for BIO257C 21. BIO257C 1 pt. 8,324
  1. Avatar for Glen B 61. Glen B Lv 1 13 pts. 15,152
  2. Avatar for MicElephant 62. MicElephant Lv 1 12 pts. 15,140
  3. Avatar for isaksson 63. isaksson Lv 1 12 pts. 15,080
  4. Avatar for tarimo 64. tarimo Lv 1 11 pts. 15,073
  5. Avatar for Bletchley Park 65. Bletchley Park Lv 1 11 pts. 15,066
  6. Avatar for tony46 66. tony46 Lv 1 10 pts. 15,062
  7. Avatar for andrewxc 67. andrewxc Lv 1 10 pts. 15,042
  8. Avatar for WBarme1234 68. WBarme1234 Lv 1 9 pts. 15,016
  9. Avatar for fryguy 69. fryguy Lv 1 9 pts. 14,977
  10. Avatar for SKSbell 70. SKSbell Lv 1 9 pts. 14,959

Comments