Placeholder image of a protein
Icon representing a puzzle

1350: Unsolved De-novo Freestyle 101: Predicted Contacts

Closed since about 9 years ago

Intermediate Overall Prediction Predicted Contacts

Summary


Created
March 06, 2017
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1347, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzles 1344 and 1347 and use them as a starting point here.



Sequence:


MLQLLLAVFIGGGTGSVARWLLSMRFNPLHQAIPLGTLTANLIGAFIIGIGFAWFSRMTNIDPVWKVLITTGFCGGLTTFSTFSAEVVFLLQEGRFGWALLNVFVNLLGSFAMTALAFWLFSASTAH

Top groups


  1. Avatar for BIO257C 21. BIO257C 1 pt. 8,324

  1. Avatar for Blipperman 71. Blipperman Lv 1 8 pts. 14,949
  2. Avatar for Deleted player 72. Deleted player pts. 14,944
  3. Avatar for khendarg 73. khendarg Lv 1 8 pts. 14,901
  4. Avatar for jamiexq 74. jamiexq Lv 1 7 pts. 14,889
  5. Avatar for phi16 75. phi16 Lv 1 7 pts. 14,874
  6. Avatar for talbers 76. talbers Lv 1 7 pts. 14,853
  7. Avatar for AeonFluff 77. AeonFluff Lv 1 6 pts. 14,845
  8. Avatar for Scopper 78. Scopper Lv 1 6 pts. 14,827
  9. Avatar for YeshuaLives 79. YeshuaLives Lv 1 6 pts. 14,803
  10. Avatar for ViJay7019 80. ViJay7019 Lv 1 5 pts. 14,790

Comments