Placeholder image of a protein
Icon representing a puzzle

1350: Unsolved De-novo Freestyle 101: Predicted Contacts

Closed since about 9 years ago

Intermediate Intermediate Overall Overall Prediction Prediction Predicted Contacts Predicted Contacts

Summary

Created
March 06, 2017
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1347, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzles 1344 and 1347 and use them as a starting point here.



Sequence:


MLQLLLAVFIGGGTGSVARWLLSMRFNPLHQAIPLGTLTANLIGAFIIGIGFAWFSRMTNIDPVWKVLITTGFCGGLTTFSTFSAEVVFLLQEGRFGWALLNVFVNLLGSFAMTALAFWLFSASTAH

Top groups

  1. Avatar for BIO257C 21. BIO257C 1 pt. 8,324
  1. Avatar for dssb 81. dssb Lv 1 5 pts. 14,785
  2. Avatar for FishKAA 82. FishKAA Lv 1 5 pts. 14,776
  3. Avatar for harvardman 83. harvardman Lv 1 5 pts. 14,773
  4. Avatar for uihcv 84. uihcv Lv 1 5 pts. 14,770
  5. Avatar for deLaCeiba 85. deLaCeiba Lv 1 4 pts. 14,764
  6. Avatar for pfirth 86. pfirth Lv 1 4 pts. 14,755
  7. Avatar for Merf 87. Merf Lv 1 4 pts. 14,753
  8. Avatar for Alistair69 88. Alistair69 Lv 1 4 pts. 14,732
  9. Avatar for YGK 89. YGK Lv 1 4 pts. 14,728
  10. Avatar for alwen 90. alwen Lv 1 3 pts. 14,724

Comments