Placeholder image of a protein
Icon representing a puzzle

1351: Revisiting Puzzle 90: Heliomicin

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
March 06, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups

  1. Avatar for GUGITBIOTECH 11. GUGITBIOTECH 7 pts. 8,526
  2. Avatar for xkcd 12. xkcd 5 pts. 8,442
  3. Avatar for Cannabis Crew 13. Cannabis Crew 4 pts. 8,369
  4. Avatar for Team Schleswig-Holstein 14. Team Schleswig-Holstein 3 pts. 8,312
  5. Avatar for Deleted group 15. Deleted group pts. 8,285
  6. Avatar for Team South Africa 16. Team South Africa 1 pt. 8,261
  7. Avatar for freefolder 17. freefolder 1 pt. 8,225
  8. Avatar for :) 18. :) 1 pt. 8,057
  9. Avatar for Deleted group 19. Deleted group pts. 7,825
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 7,807
  1. Avatar for reefyrob
    1. reefyrob Lv 1
    100 pts. 9,420
  2. Avatar for LociOiling 2. LociOiling Lv 1 84 pts. 9,420
  3. Avatar for smilingone 3. smilingone Lv 1 70 pts. 9,419
  4. Avatar for bertro 4. bertro Lv 1 58 pts. 9,417
  5. Avatar for retiredmichael 5. retiredmichael Lv 1 48 pts. 9,416
  6. Avatar for toshiue 6. toshiue Lv 1 39 pts. 9,383
  7. Avatar for NinjaGreg 7. NinjaGreg Lv 1 32 pts. 9,372
  8. Avatar for Bruno Kestemont 8. Bruno Kestemont Lv 1 26 pts. 9,369
  9. Avatar for pauldunn 9. pauldunn Lv 1 20 pts. 9,368
  10. Avatar for gitwut 10. gitwut Lv 1 16 pts. 9,329

Comments