Placeholder image of a protein
Icon representing a puzzle

1351: Revisiting Puzzle 90: Heliomicin

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
March 06, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups

  1. Avatar for GUGITBIOTECH 11. GUGITBIOTECH 7 pts. 8,526
  2. Avatar for xkcd 12. xkcd 5 pts. 8,442
  3. Avatar for Cannabis Crew 13. Cannabis Crew 4 pts. 8,369
  4. Avatar for Team Schleswig-Holstein 14. Team Schleswig-Holstein 3 pts. 8,312
  5. Avatar for Deleted group 15. Deleted group pts. 8,285
  6. Avatar for Team South Africa 16. Team South Africa 1 pt. 8,261
  7. Avatar for freefolder 17. freefolder 1 pt. 8,225
  8. Avatar for :) 18. :) 1 pt. 8,057
  9. Avatar for Deleted group 19. Deleted group pts. 7,825
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 7,807
  1. Avatar for cobaltteal 81. cobaltteal Lv 1 8 pts. 8,881
  2. Avatar for saksoft2 82. saksoft2 Lv 1 7 pts. 8,872
  3. Avatar for Formula350 83. Formula350 Lv 1 7 pts. 8,870
  4. Avatar for uihcv 84. uihcv Lv 1 7 pts. 8,866
  5. Avatar for YeshuaLives 85. YeshuaLives Lv 1 6 pts. 8,855
  6. Avatar for harvardman 86. harvardman Lv 1 6 pts. 8,854
  7. Avatar for philcalhoun 87. philcalhoun Lv 1 6 pts. 8,854
  8. Avatar for JUMELLE54 88. JUMELLE54 Lv 1 6 pts. 8,818
  9. Avatar for ppp6 89. ppp6 Lv 1 5 pts. 8,784
  10. Avatar for Deleted player 90. Deleted player pts. 8,773

Comments