Placeholder image of a protein
Icon representing a puzzle

1351: Revisiting Puzzle 90: Heliomicin

Closed since about 9 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
March 06, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups


  1. Avatar for WA HBio 2017 21. WA HBio 2017 1 pt. 7,800
  2. Avatar for SciOne2017 22. SciOne2017 1 pt. 7,753
  3. Avatar for BMB401_SP17 23. BMB401_SP17 1 pt. 7,638
  4. Avatar for Window Group 24. Window Group 1 pt. 6,899
  5. Avatar for Deleted group 25. Deleted group pts. 0

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 9,420
  2. Avatar for fiendish_ghoul 2. fiendish_ghoul Lv 1 98 pts. 9,376
  3. Avatar for ZeroLeak7 3. ZeroLeak7 Lv 1 95 pts. 9,376
  4. Avatar for johnmitch 4. johnmitch Lv 1 93 pts. 9,358
  5. Avatar for retiredmichael 5. retiredmichael Lv 1 91 pts. 9,353
  6. Avatar for Bruno Kestemont 6. Bruno Kestemont Lv 1 88 pts. 9,344
  7. Avatar for reefyrob 7. reefyrob Lv 1 86 pts. 9,333
  8. Avatar for hpaege 8. hpaege Lv 1 84 pts. 9,330
  9. Avatar for Bletchley Park 9. Bletchley Park Lv 1 82 pts. 9,329
  10. Avatar for christioanchauvin 10. christioanchauvin Lv 1 79 pts. 9,326

Comments