Placeholder image of a protein
Icon representing a puzzle

1351: Revisiting Puzzle 90: Heliomicin

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
March 06, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups

  1. Avatar for WA HBio 2017 21. WA HBio 2017 1 pt. 7,800
  2. Avatar for SciOne2017 22. SciOne2017 1 pt. 7,753
  3. Avatar for BMB401_SP17 23. BMB401_SP17 1 pt. 7,638
  4. Avatar for Window Group 24. Window Group 1 pt. 6,899
  5. Avatar for Deleted group 25. Deleted group pts. 0
  1. Avatar for tony46 91. tony46 Lv 1 5 pts. 8,743
  2. Avatar for joaniegirl 92. joaniegirl Lv 1 5 pts. 8,731
  3. Avatar for talbers 93. talbers Lv 1 5 pts. 8,730
  4. Avatar for Nick_Flamel 94. Nick_Flamel Lv 1 4 pts. 8,691
  5. Avatar for Jim Fraser 95. Jim Fraser Lv 1 4 pts. 8,642
  6. Avatar for NotJim99 96. NotJim99 Lv 1 4 pts. 8,634
  7. Avatar for eromana 97. eromana Lv 1 4 pts. 8,601
  8. Avatar for Perhonen 98. Perhonen Lv 1 4 pts. 8,600
  9. Avatar for jbmkfm125 99. jbmkfm125 Lv 1 3 pts. 8,578
  10. Avatar for froggs554 100. froggs554 Lv 1 3 pts. 8,576

Comments