Placeholder image of a protein
Icon representing a puzzle

1351: Revisiting Puzzle 90: Heliomicin

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
March 06, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups

  1. Avatar for WA HBio 2017 21. WA HBio 2017 1 pt. 7,800
  2. Avatar for SciOne2017 22. SciOne2017 1 pt. 7,753
  3. Avatar for BMB401_SP17 23. BMB401_SP17 1 pt. 7,638
  4. Avatar for Window Group 24. Window Group 1 pt. 6,899
  5. Avatar for Deleted group 25. Deleted group pts. 0
  1. Avatar for leehaggis 121. leehaggis Lv 1 1 pt. 8,365
  2. Avatar for pooja chennupati 122. pooja chennupati Lv 1 1 pt. 8,343
  3. Avatar for starkid 123. starkid Lv 1 1 pt. 8,340
  4. Avatar for AeonFluff 124. AeonFluff Lv 1 1 pt. 8,337
  5. Avatar for benrh 125. benrh Lv 1 1 pt. 8,336
  6. Avatar for josaphat 126. josaphat Lv 1 1 pt. 8,334
  7. Avatar for Sanechik 127. Sanechik Lv 1 1 pt. 8,325
  8. Avatar for gu14003 128. gu14003 Lv 1 1 pt. 8,316
  9. Avatar for MuckeMcFly 129. MuckeMcFly Lv 1 1 pt. 8,312
  10. Avatar for val.sch67 130. val.sch67 Lv 1 1 pt. 8,295

Comments