Placeholder image of a protein
Icon representing a puzzle

1351: Revisiting Puzzle 90: Heliomicin

Closed since about 9 years ago

Intermediate Overall Prediction

Summary


Created
March 06, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups


  1. Avatar for WA HBio 2017 21. WA HBio 2017 1 pt. 7,800
  2. Avatar for SciOne2017 22. SciOne2017 1 pt. 7,753
  3. Avatar for BMB401_SP17 23. BMB401_SP17 1 pt. 7,638
  4. Avatar for Window Group 24. Window Group 1 pt. 6,899
  5. Avatar for Deleted group 25. Deleted group pts. 0

  1. Avatar for sielenk 151. sielenk Lv 1 1 pt. 8,110
  2. Avatar for WarFairy 152. WarFairy Lv 1 1 pt. 8,097
  3. Avatar for Arshad.h 153. Arshad.h Lv 1 1 pt. 8,096
  4. Avatar for dahast.de 154. dahast.de Lv 1 1 pt. 8,089
  5. Avatar for 1210115146 155. 1210115146 Lv 1 1 pt. 8,079
  6. Avatar for machinelves 156. machinelves Lv 1 1 pt. 8,057
  7. Avatar for jebbiek 157. jebbiek Lv 1 1 pt. 8,057
  8. Avatar for pandapharmd 158. pandapharmd Lv 1 1 pt. 8,019
  9. Avatar for Fetztastic 159. Fetztastic Lv 1 1 pt. 8,004
  10. Avatar for Cerzax 160. Cerzax Lv 1 1 pt. 7,996

Comments