Placeholder image of a protein
Icon representing a puzzle

1351: Revisiting Puzzle 90: Heliomicin

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
March 06, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups

  1. Avatar for WA HBio 2017 21. WA HBio 2017 1 pt. 7,800
  2. Avatar for SciOne2017 22. SciOne2017 1 pt. 7,753
  3. Avatar for BMB401_SP17 23. BMB401_SP17 1 pt. 7,638
  4. Avatar for Window Group 24. Window Group 1 pt. 6,899
  5. Avatar for Deleted group 25. Deleted group pts. 0
  1. Avatar for BMB401_awm5777 181. BMB401_awm5777 Lv 1 1 pt. 7,638
  2. Avatar for 17willa 182. 17willa Lv 1 1 pt. 7,410
  3. Avatar for License to war 183. License to war Lv 1 1 pt. 7,164
  4. Avatar for jflat06 184. jflat06 Lv 1 1 pt. 6,899
  5. Avatar for Crodino95 185. Crodino95 Lv 1 1 pt. 4,924
  6. Avatar for Scopper 186. Scopper Lv 1 1 pt. 2,550
  7. Avatar for aurabum 187. aurabum Lv 1 1 pt. 0
  8. Avatar for skardt11 188. skardt11 Lv 1 1 pt. 0
  9. Avatar for alcor29 189. alcor29 Lv 1 1 pt. 0
  10. Avatar for andrewtmaxwell 190. andrewtmaxwell Lv 1 1 pt. 0

Comments