Placeholder image of a protein
Icon representing a puzzle

1351: Revisiting Puzzle 90: Heliomicin

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
March 06, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups

  1. Avatar for WA HBio 2017 21. WA HBio 2017 1 pt. 7,800
  2. Avatar for SciOne2017 22. SciOne2017 1 pt. 7,753
  3. Avatar for BMB401_SP17 23. BMB401_SP17 1 pt. 7,638
  4. Avatar for Window Group 24. Window Group 1 pt. 6,899
  5. Avatar for Deleted group 25. Deleted group pts. 0
  1. Avatar for Galaxie 21. Galaxie Lv 1 59 pts. 9,275
  2. Avatar for eusair 22. eusair Lv 1 57 pts. 9,274
  3. Avatar for Aubade01 23. Aubade01 Lv 1 55 pts. 9,270
  4. Avatar for Skippysk8s 24. Skippysk8s Lv 1 54 pts. 9,269
  5. Avatar for kabubi 25. kabubi Lv 1 52 pts. 9,267
  6. Avatar for nicobul 26. nicobul Lv 1 51 pts. 9,266
  7. Avatar for Blipperman 27. Blipperman Lv 1 49 pts. 9,265
  8. Avatar for shettler 28. shettler Lv 1 48 pts. 9,264
  9. Avatar for tarimo 29. tarimo Lv 1 46 pts. 9,262
  10. Avatar for smilingone 30. smilingone Lv 1 45 pts. 9,259

Comments