Placeholder image of a protein
Icon representing a puzzle

1351: Revisiting Puzzle 90: Heliomicin

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
March 06, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups

  1. Avatar for WA HBio 2017 21. WA HBio 2017 1 pt. 7,800
  2. Avatar for SciOne2017 22. SciOne2017 1 pt. 7,753
  3. Avatar for BMB401_SP17 23. BMB401_SP17 1 pt. 7,638
  4. Avatar for Window Group 24. Window Group 1 pt. 6,899
  5. Avatar for Deleted group 25. Deleted group pts. 0
  1. Avatar for crpainter 31. crpainter Lv 1 44 pts. 9,256
  2. Avatar for tokens 32. tokens Lv 1 42 pts. 9,252
  3. Avatar for jobo0502 33. jobo0502 Lv 1 41 pts. 9,247
  4. Avatar for Vredeman 34. Vredeman Lv 1 40 pts. 9,244
  5. Avatar for NinjaGreg 35. NinjaGreg Lv 1 39 pts. 9,237
  6. Avatar for deLaCeiba 36. deLaCeiba Lv 1 37 pts. 9,233
  7. Avatar for pvc78 37. pvc78 Lv 1 36 pts. 9,227
  8. Avatar for demeter900 38. demeter900 Lv 1 35 pts. 9,226
  9. Avatar for stomjoh 39. stomjoh Lv 1 34 pts. 9,224
  10. Avatar for randomlil 40. randomlil Lv 1 33 pts. 9,218

Comments