Placeholder image of a protein
Icon representing a puzzle

1351: Revisiting Puzzle 90: Heliomicin

Closed since about 9 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary

Created
March 06, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups

  1. Avatar for WA HBio 2017 21. WA HBio 2017 1 pt. 7,800
  2. Avatar for SciOne2017 22. SciOne2017 1 pt. 7,753
  3. Avatar for BMB401_SP17 23. BMB401_SP17 1 pt. 7,638
  4. Avatar for Window Group 24. Window Group 1 pt. 6,899
  5. Avatar for Deleted group 25. Deleted group pts. 0
  1. Avatar for mimi 41. mimi Lv 1 32 pts. 9,215
  2. Avatar for isaksson 42. isaksson Lv 1 31 pts. 9,195
  3. Avatar for joremen 43. joremen Lv 1 30 pts. 9,191
  4. Avatar for Vinara 44. Vinara Lv 1 29 pts. 9,183
  5. Avatar for Norrjane 45. Norrjane Lv 1 28 pts. 9,180
  6. Avatar for weitzen 46. weitzen Lv 1 27 pts. 9,176
  7. Avatar for MicElephant 47. MicElephant Lv 1 26 pts. 9,174
  8. Avatar for dbuske 48. dbuske Lv 1 25 pts. 9,174
  9. Avatar for SKSbell 49. SKSbell Lv 1 25 pts. 9,171
  10. Avatar for Keresto 50. Keresto Lv 1 24 pts. 9,168

Comments