Placeholder image of a protein
Icon representing a puzzle

1351: Revisiting Puzzle 90: Heliomicin

Closed since about 9 years ago

Intermediate Overall Prediction

Summary


Created
March 06, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups


  1. Avatar for WA HBio 2017 21. WA HBio 2017 1 pt. 7,800
  2. Avatar for SciOne2017 22. SciOne2017 1 pt. 7,753
  3. Avatar for BMB401_SP17 23. BMB401_SP17 1 pt. 7,638
  4. Avatar for Window Group 24. Window Group 1 pt. 6,899
  5. Avatar for Deleted group 25. Deleted group pts. 0

  1. Avatar for toshiue 61. toshiue Lv 1 16 pts. 9,110
  2. Avatar for hansvandenhof 62. hansvandenhof Lv 1 16 pts. 9,083
  3. Avatar for Deleted player 63. Deleted player pts. 9,072
  4. Avatar for Glen B 64. Glen B Lv 1 15 pts. 9,069
  5. Avatar for Fat Tony 65. Fat Tony Lv 1 14 pts. 9,069
  6. Avatar for Anfinsen_slept_here 66. Anfinsen_slept_here Lv 1 13 pts. 9,065
  7. Avatar for phi16 67. phi16 Lv 1 13 pts. 9,054
  8. Avatar for alwen 68. alwen Lv 1 13 pts. 9,040
  9. Avatar for katling 69. katling Lv 1 12 pts. 8,990
  10. Avatar for O Seki To 70. O Seki To Lv 1 12 pts. 8,976

Comments