Placeholder image of a protein
Icon representing a puzzle

1351: Revisiting Puzzle 90: Heliomicin

Closed since about 9 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
March 06, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups


  1. Avatar for Beta Folders 100 pts. 9,420
  2. Avatar for Go Science 2. Go Science 81 pts. 9,383
  3. Avatar for Contenders 3. Contenders 65 pts. 9,329
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 52 pts. 9,326
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 41 pts. 9,326
  6. Avatar for Gargleblasters 6. Gargleblasters 32 pts. 9,317
  7. Avatar for Void Crushers 7. Void Crushers 24 pts. 9,302
  8. Avatar for Italiani Al Lavoro 8. Italiani Al Lavoro 18 pts. 9,233
  9. Avatar for HMT heritage 9. HMT heritage 14 pts. 8,976
  10. Avatar for Natural Abilities 10. Natural Abilities 10 pts. 8,958

  1. Avatar for kcrowthers 171. kcrowthers Lv 1 1 pt. 7,800
  2. Avatar for todrik 172. todrik Lv 1 1 pt. 7,788
  3. Avatar for trentis1 173. trentis1 Lv 1 1 pt. 7,787
  4. Avatar for Cource 174. Cource Lv 1 1 pt. 7,785
  5. Avatar for rhwood55 175. rhwood55 Lv 1 1 pt. 7,759
  6. Avatar for Astralist 176. Astralist Lv 1 1 pt. 7,757
  7. Avatar for 55SciOne 177. 55SciOne Lv 1 1 pt. 7,753
  8. Avatar for Apolloid 178. Apolloid Lv 1 1 pt. 7,750
  9. Avatar for Alekhya.vytla 179. Alekhya.vytla Lv 1 1 pt. 7,687
  10. Avatar for seba6029 180. seba6029 Lv 1 1 pt. 7,668

Comments