Placeholder image of a protein
Icon representing a puzzle

1351: Revisiting Puzzle 90: Heliomicin

Closed since about 9 years ago

Intermediate Overall Prediction

Summary


Created
March 06, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups


  1. Avatar for Beta Folders 100 pts. 9,420
  2. Avatar for Go Science 2. Go Science 81 pts. 9,383
  3. Avatar for Contenders 3. Contenders 65 pts. 9,329
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 52 pts. 9,326
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 41 pts. 9,326
  6. Avatar for Gargleblasters 6. Gargleblasters 32 pts. 9,317
  7. Avatar for Void Crushers 7. Void Crushers 24 pts. 9,302
  8. Avatar for Italiani Al Lavoro 8. Italiani Al Lavoro 18 pts. 9,233
  9. Avatar for HMT heritage 9. HMT heritage 14 pts. 8,976
  10. Avatar for Natural Abilities 10. Natural Abilities 10 pts. 8,958

  1. Avatar for Galaxie 21. Galaxie Lv 1 59 pts. 9,275
  2. Avatar for eusair 22. eusair Lv 1 57 pts. 9,274
  3. Avatar for Aubade01 23. Aubade01 Lv 1 55 pts. 9,270
  4. Avatar for Skippysk8s 24. Skippysk8s Lv 1 54 pts. 9,269
  5. Avatar for kabubi 25. kabubi Lv 1 52 pts. 9,267
  6. Avatar for nicobul 26. nicobul Lv 1 51 pts. 9,266
  7. Avatar for Blipperman 27. Blipperman Lv 1 49 pts. 9,265
  8. Avatar for shettler 28. shettler Lv 1 48 pts. 9,264
  9. Avatar for tarimo 29. tarimo Lv 1 46 pts. 9,262
  10. Avatar for smilingone 30. smilingone Lv 1 45 pts. 9,259

Comments