Placeholder image of a protein
Icon representing a puzzle

1351: Revisiting Puzzle 90: Heliomicin

Closed since about 9 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
March 06, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups


  1. Avatar for Beta Folders 100 pts. 9,420
  2. Avatar for Go Science 2. Go Science 81 pts. 9,383
  3. Avatar for Contenders 3. Contenders 65 pts. 9,329
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 52 pts. 9,326
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 41 pts. 9,326
  6. Avatar for Gargleblasters 6. Gargleblasters 32 pts. 9,317
  7. Avatar for Void Crushers 7. Void Crushers 24 pts. 9,302
  8. Avatar for Italiani Al Lavoro 8. Italiani Al Lavoro 18 pts. 9,233
  9. Avatar for HMT heritage 9. HMT heritage 14 pts. 8,976
  10. Avatar for Natural Abilities 10. Natural Abilities 10 pts. 8,958

  1. Avatar for toshiue 61. toshiue Lv 1 16 pts. 9,110
  2. Avatar for hansvandenhof 62. hansvandenhof Lv 1 16 pts. 9,083
  3. Avatar for Deleted player 63. Deleted player pts. 9,072
  4. Avatar for Glen B 64. Glen B Lv 1 15 pts. 9,069
  5. Avatar for Fat Tony 65. Fat Tony Lv 1 14 pts. 9,069
  6. Avatar for Anfinsen_slept_here 66. Anfinsen_slept_here Lv 1 13 pts. 9,065
  7. Avatar for phi16 67. phi16 Lv 1 13 pts. 9,054
  8. Avatar for alwen 68. alwen Lv 1 13 pts. 9,040
  9. Avatar for katling 69. katling Lv 1 12 pts. 8,990
  10. Avatar for O Seki To 70. O Seki To Lv 1 12 pts. 8,976

Comments